Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RFC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RFC5 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15810820
|
Novus Biologicals
NBP15810820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158108
|
Novus Biologicals
NBP158108 |
100 μL |
Each for $487.50
|
|
|||||
Description
RFC5 Polyclonal specifically detects RFC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RFC5 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, DNA Repair | |
| Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RF-C 36 kDa subunit, RFC36replication factor C (activator 1) 5 (36.5kD) | |
| RFC5 | |
| IgG | |
| This product is specific to Subunit or Isoform: 5. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| P40937 | |
| 5985 | |
| Synthetic peptides corresponding to RFC5(replication factor C (activator 1) 5, 36.5kDa) The peptide sequence was selected from the N terminal of RFC5. Peptide sequence METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title