RFC5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158108

Catalog No. NBP158108

Description

RFC5 Polyclonal specifically detects RFC5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RFC5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Activator 1 36 kDa subunit, Activator 1 subunit 5,36.5 kD subunit, MGC1155, replication factor C (activator 1) 5, 36.5kDa, RF-C 36 kDa subunit, RFC36replication factor C (activator 1) 5 (36.5kD)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 5.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P40937
• Gene Symbols: RFC5
• Immunogen: Synthetic peptides corresponding to RFC5(replication factor C (activator 1) 5, 36.5kDa) The peptide sequence was selected from the N terminal of RFC5. Peptide sequence METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, DNA Repair
• Gene ID (Entrez): 5985
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.