Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RFPL4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RFPL4B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RFPL4B Polyclonal specifically detects RFPL4B in Human samples. It is validated for Western Blot.Specifications
RFPL4B | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
Q6ZWI9 | |
442247 | |
Synthetic peptides corresponding to RFPL4B(ret finger protein-like 4B) The peptide sequence was selected from the middle region of RFPL4B. Peptide sequence EVGEVKSWSLGVCKEPADRKSNDLFPEHGFWISMKAGAIHANTHLERIPA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
ret finger protein-like 4B, RNF211RING finger protein 211 | |
RFPL4B | |
IgG | |
30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title