RFWD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25881925UL

Catalog No. NB435267

Description

RFWD3 Polyclonal specifically detects RFWD3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RFWD3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 6.3.2.-, FLJ10520, ring finger and WD repeat domain 3, RING finger and WD repeat domain-containing protein 3, RING finger protein 201, RNF201E3 ubiquitin-protein ligase RFWD3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RFWD3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NHTIPASSLHSMTNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDAYFQVSRTQPDLPATTYDSETRNPVSE
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 55159
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only