Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RFX1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31775925UL
This item is not returnable.
View return policy
Description
RFX1 Polyclonal antibody specifically detects RFX1 in Human samples. It is validated for ImmunofluorescenceSpecifications
RFX1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
EFC, EF-C, Enhancer factor C, MHC class II regulatory factor RFX, MHC class II regulatory factor RFX1, Regulatory factor X 1, regulatory factor X, 1 (influences HLA class II expression), RFX, trans-acting regulatory factor 1, Transcription factor RFX1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: DASYTASAIRSSTYSYPETPLYTQTASTSYYEAAGTATQVSTPATSQAVASSGSMPMYVSGSQV | |
25 μg | |
Immunology | |
5989 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction