Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGD1560617 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen RGD1560617
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB123644
View Documents
Novus Biologicals
NBP30937125UL
25 μg N/A
NB123643
View Documents
Novus Biologicals
NBP309371100UL
100 μg N/A
Description

Description

RGD1560617 Polyclonal antibody specifically detects RGD1560617 in Rat samples. It is validated for Western Blot
Specifications

Specifications

RGD1560617
Western Blot
Purified
RUO
PBS buffer, 2% sucrose
The immunogen is a synthetic peptide directed towards the middle region of Rat RGD1560617 (XP_238518). Peptide sequence LKEKAMIEDEKKDEEKEDPKGIPEFWLTDFKNVDLLSDMVQEHDEPILKP
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Rat
300135
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit