Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGS7 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen RGS7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18051320
View Documents
Novus Biologicals
NBP18051320UL
20 μL
Each for $152.22
Add to cart
 
NBP180513
View Documents
Novus Biologicals
NBP180513
100 μL
Each for $436.00
Add to cart
 
Description

Description

RGS7 Polyclonal specifically detects RGS7 in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

RGS7
Polyclonal
Purified
RUO
NP_036010
6000
Synthetic peptide directed towards the N terminal of mouse Rgs7. Peptide sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
regulator of G-protein signaling 7, regulator of G-protein signaling RGS7, regulator of G-protein signalling 7
RGS7
IgG
Protein A purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit