Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS7 Rabbit anti-Human, Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | RGS7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18051320
|
Novus Biologicals
NBP18051320UL |
20 μL |
Each for $152.22
|
|
NBP180513
|
Novus Biologicals
NBP180513 |
100 μL |
Each for $436.00
|
|
Description
RGS7 Polyclonal specifically detects RGS7 in Human, Mouse samples. It is validated for Western Blot.Specifications
RGS7 | |
Polyclonal | |
Purified | |
RUO | |
NP_036010 | |
6000 | |
Synthetic peptide directed towards the N terminal of mouse Rgs7. Peptide sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
regulator of G-protein signaling 7, regulator of G-protein signaling RGS7, regulator of G-protein signalling 7 | |
RGS7 | |
IgG | |
Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title