Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RGS7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18051320
|
Novus Biologicals
NBP18051320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP180513
|
Novus Biologicals
NBP180513 |
100 μL |
Each for $487.50
|
|
|||||
Description
RGS7 Polyclonal specifically detects RGS7 in Mouse samples. It is validated for Western Blot.Specifications
| RGS7 | |
| Polyclonal | |
| Purified | |
| RUO | |
| regulator of G-protein signaling 7, regulator of G-protein signaling RGS7, regulator of G-protein signalling 7 | |
| RGS7 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_036010 | |
| 6000 | |
| Synthetic peptide directed towards the N terminal of mouse Rgs7. Peptide sequence MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title