RHEBL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23258125UL

Catalog No. NB404822

Description

RHEBL1 Polyclonal specifically detects RHEBL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RHEBL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: FLJ25797, GTPase RhebL1, MGC34869, Ras homolog enriched in brain like 1, Ras homolog enriched in brain like 1 c, Ras homolog enriched in brain like-1 c, Ras homolog enriched in brain-like protein 1, Rheb2, RHEBL1c, Rheb-like protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RHEBL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSARENQLTQGIFTKVIQEIARVENSYGQERRCHLM
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 121268
• Target Species: Human
• Isotype: IgG

For Research Use Only