Learn More
Invitrogen™ RhoB Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA595631
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, monkey COS-7 whole cell. IHC: human renal cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Rho-related GTP-binding protein (RhoB) mediates apoptosis in neoplastically transformed cells after DNA damage. While not essential for development, it does affect cell adhesion and growth factor signaling in transformed cells. RhoB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a tumor supressor - deletion of RhoB causes tumor formation.
Specifications
RhoB | |
Polyclonal | |
Unconjugated | |
RHOB | |
AA017882; Aplysia RAS-related homolog 6; aplysia ras-related homolog B; Arh6; Arhb; h6; MST081; MSTP081; oncogene RHO H6; ras homolog B; ras homolog family member B; ras homolog gene family, member AB; ras homolog gene family, member B; Rho; rho cDNA clone 6; rhoB; RHOH6; Rho-related GTP-binding protein RhoB | |
Rabbit | |
Affinity chromatography | |
RUO | |
11852, 388, 64373 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry | |
500 μg/mL | |
PBS with 4 mg trehalose and 0.05 mg sodium azide | |
P62745, P62746, P62747 | |
RHOB | |
A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE). | |
100 μg | |
Primary | |
Human, Mouse, Rat, Monkey | |
Antibody | |
IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.