Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RhoG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17979420UL
Description
RhoG Polyclonal specifically detects RhoG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| RhoG | |
| Polyclonal | |
| Western Blot 1:1000, Immunohistochemistry | |
| NP_001656 | |
| RHOG | |
| Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ. | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), RhoG, rho-related GTP-binding protein RhoG | |
| Rabbit | |
| 21 kDa | |
| 20 μL | |
| Cell Cycle and Replication | |
| 391 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction