Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RhoG Antibody, Novus Biologicals™

RhoG Antibody, Novus Biologicals™
SDP

Catalog No. NBP17979420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17979420 20 μL
NBP179794 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17979420 Supplier Novus Biologicals Supplier No. NBP17979420UL

Description

Rabbit Polyclonal Antibody

RhoG Polyclonal specifically detects RhoG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RhoG
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_001656
Gene Alias ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), RhoG, rho-related GTP-binding protein RhoG
Gene Symbols RHOG
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 391
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.