Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RhoG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RhoG
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17979420 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17979420UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP179794 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179794	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RhoG Polyclonal specifically detects RhoG in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	RhoG
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	NP_001656
Gene ID (Entrez)	391
Immunogen	Synthetic peptide directed towards the C terminal of human RHOGThe immunogen for this antibody is RHOG. Peptide sequence LVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQ.
Primary or Secondary	Primary

Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cell Cycle and Replication
Gene Alias	ARHGMGC125835, MGC125836, ras homolog gene family, member G (rho G), RhoG, rho-related GTP-binding protein RhoG
Gene Symbols	RHOG
Isotype	IgG
Molecular Weight of Antigen	21 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RhoG Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents