Rhophilin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213231

Catalog No. NBP213231

Description

Rhophilin 2 Polyclonal specifically detects Rhophilin 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Rhophilin 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: GTP-Rho-binding protein 2, P76RBE, RHOBP, rhophilin 2,76 kDa RhoB effector protein, rhophilin, Rho GTPase binding protein 2, rhophilin-2, rhophilin-like Rho-GTPase binding protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RHPN2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: DHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHHEESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 85415
• Target Species: Human
• Isotype: IgG

For Research Use Only