Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RIAM/APBB1IP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23900925UL
Description
RIAM/APBB1IP Polyclonal specifically detects RIAM/APBB1IP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
RIAM/APBB1IP | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Q7Z5R6 | |
APBB1IP | |
This antibody was developed against a recombinant protein corresponding to amino acids: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
amyloid beta (A4) precursor protein-binding, family B, member 1 interactingprotein, amyloid beta A4 precursor protein-binding family B member 1-interacting protein, APBB1-interacting protein 1, INAG1, PREL1, PREL-1, proline rich EVH1 ligand 1, Proline-rich EVH1 ligand 1, Proline-rich protein 73, Rap1-GTP-interacting adapter molecule, Rap1-interacting adaptor molecule, RARP1, Retinoic acid-responsive proline-rich protein 1, RIAMRARP-1 | |
Rabbit | |
Affinity Purified | |
RUO | |
54518 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction