Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ribonuclease A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169256
Description
Ribonuclease A Polyclonal antibody specifically detects Ribonuclease A in Human, Mouse samples. It is validated for Western Blot.Specifications
Ribonuclease A | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
EC 3.1.27.5, HP-RNase, MGC12408, RIB1, RIB-1, Ribonuclease 1, Ribonuclease A, ribonuclease pancreatic, ribonuclease, RNase A family, 1 (pancreatic), RNase A, RNase UpI-1, RNS1RNase 1 | |
Rabbit | |
15 kDa | |
100 μL | |
DNA replication Transcription Translation and Splicing, Proteases & Other Enzymes | |
6035 | |
Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Goat, Rabbit, Sheep | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P07998 | |
RNASE1 | |
Synthetic peptides corresponding to RNASE1(ribonuclease, RNase A family, 1 (pancreatic)) The peptide sequence was selected from the middle region of RNASE1. Peptide sequence MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST. | |
Affinity purified | |
RUO | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction