Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RICS Antibody, Novus Biologicals™

RICS Antibody, Novus Biologicals™
SDP

Catalog No. NBP238408 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238408 0.1 mL
NB404664 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238408 Supplier Novus Biologicals Supplier No. NBP238408
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RICS Polyclonal specifically detects RICS in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RICS
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. A7KAX9
Gene Alias brain-specific Rho GTP-ase-activating protein, Brain-specific Rho GTPase-activating protein, GAB-associated CDC42, GAB-associated Cdc42/Rac GTPase-activating protein, GC-GAPGTPase regulator interacting with TrkA, GRITp200RhoGAP, KIAA0712p250GAP, MGC1892, rac GTPase activating protein, Rho GTPase activating protein 32, rho GTPase-activating protein 32, Rho/Cdc42/Rac GTPase-activating protein RICS, RhoGAP involved in the beta-catenin-N-cadherin and NMDA receptor signaling, RhoGAP involved in the -catenin-N-cadherin and NMDA receptor signaling, Rho-type GTPase-activating protein 32, RICSPX-RICS
Gene Symbols ARHGAP32
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQNNAPGNCDHPLPETTATGDPTHSNTTESGEQHHQVDLTGNQPHQAYLSGDPEKARITSVP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9743
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.