Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RIIAD1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP194117
Description
RIIAD1 Polyclonal specifically detects RIIAD1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
RIIAD1 | |
Polyclonal | |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
NCRNA00166, regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1, RIIa domain-containing protein 1, RIIa domain-containing protein ENSP00000357824 | |
Rabbit | |
Affinity Purified | |
RUO | |
284485 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
RIIAD1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:METLPGLLQRPDPGALSAAQLEQLRKFKIQTRIANEKYLRTHKEVEWLISGFFREIFLKRPDNILEFAADYFTDPRLPNKIH | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction