Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNA polymerase I termination factor Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNA polymerase I termination factor |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNA polymerase I termination factor Polyclonal specifically detects RNA polymerase I termination factor in Human samples. It is validated for Western Blot.Specifications
RNA polymerase I termination factor | |
Polyclonal | |
Rabbit | |
Human | |
RNA polymerase I termination factor, transcription termination factor 1, Transcription termination factor I, transcription termination factor, RNA polymerase I, TTF-1, TTF-I | |
TTF1 | |
IgG | |
103 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q15361 | |
7270 | |
Synthetic peptides corresponding to the middle region of TTF1. Immunizing peptide sequence KNSESTLFDSVEGDGAMMEEGVKSRPRQKKTQACLASKHVQEAPRLEPAN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title