Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASE11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNASE11 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNASE11 Polyclonal specifically detects RNASE11 in Human samples. It is validated for Western Blot.Specifications
RNASE11 | |
Polyclonal | |
Rabbit | |
Q8TAA1 | |
122651 | |
Synthetic peptides corresponding to RNASE11(ribonuclease, RNase A family, 11 (non-active)) The peptide sequence was selected from the middle region of RNASE11. Peptide sequence GISCCESLELENTVCQFTTGKQFPRCQYHSVTSLEKILTVLTGHSLMSWL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C14orf6, chromosome 14 open reading frame 6, EC 3.1.27.-, probable ribonuclease 11, ribonuclease 11, ribonuclease, RNase A family, 11 (non-active), RNase 11 | |
RNASE11 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title