Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASE9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | RNASE9 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP155370
![]() |
Novus Biologicals
NBP155370 |
100 μL |
Each for $480.74
|
|
|||||
NBP15537020
![]() |
Novus Biologicals
NBP15537020UL |
20 μL | N/A | N/A | N/A | ||||
Description
RNASE9 Polyclonal specifically detects RNASE9 in Human samples. It is validated for Western Blot.Specifications
| RNASE9 | |
| Polyclonal | |
| Rabbit | |
| P60153 | |
| 390443 | |
| Synthetic peptides corresponding to RNASE9(ribonuclease, RNase A family, 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| h461, HEL128, ribonuclear enzyme, ribonuclease 9, ribonuclease, RNase A family, 9 (non-active), ribonuclease-like protein 9 | |
| RNASE9 | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title