Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNASET2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18001720UL
Description
RNASET2 Polyclonal specifically detects RNASET2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
RNASET2 | |
Polyclonal | |
Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence | |
NP_003721 | |
RNASET2 | |
Synthetic peptide directed towards the middle region of human RNASET2. Peptide sequence RSRFWKHEWEKHGTCAAQVDALNSQKKYFGRSLELYRELDLNSVLLKLGI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 3.1.27.-, EC 3.1.27.1, FLJ10907, FLJ42372, Ribonuclease 6, ribonuclease T2, RNASE6PLbA514O12.3 | |
Rabbit | |
Affinity Purified | |
RUO | |
8635 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction