Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF148 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | RNF148 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RNF148 Polyclonal specifically detects RNF148 in Human samples. It is validated for Western Blot.Specifications
| RNF148 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| MGC35222, ring finger protein 148 | |
| RNF148 | |
| IgG | |
| 34 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N7C7 | |
| 378925 | |
| Synthetic peptides corresponding to RNF148(ring finger protein 148) The peptide sequence was selected from the C terminal of RNF148 (NP_932351). Peptide sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title