Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF148 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF148 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNF148 Polyclonal specifically detects RNF148 in Human samples. It is validated for Western Blot.Specifications
RNF148 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
MGC35222, ring finger protein 148 | |
RNF148 | |
IgG | |
34 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8N7C7 | |
378925 | |
Synthetic peptides corresponding to RNF148(ring finger protein 148) The peptide sequence was selected from the C terminal of RNF148 (NP_932351). Peptide sequence PNSFTRRRSQIKTDVKKAIDQLQLRVLKEGDEELDLNEDNCVVCFDTYKP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title