Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF165 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF165 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
RNF165 Polyclonal specifically detects RNF165 in Human samples. It is validated for Western Blot.Specifications
RNF165 | |
Polyclonal | |
Purified | |
RUO | |
494470 | |
Synthetic peptides corresponding to RNF165(ring finger protein 165) The peptide sequence was selected from the N terminal of RNF165. Peptide sequence MVLVHVGYLVLPVFGSVRNRGAPFQRSQHPHATSCRHFHLGPPQPQQLAP. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
ARKL2, ring finger protein 165 | |
RNF165 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title