Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF165 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RNF165
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17069620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP17069620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP170696 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP170696	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RNF165 Polyclonal specifically detects RNF165 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	RNF165
Classification	Polyclonal
Host Species	Rabbit
Gene Alias	ARKL2, ring finger protein 165
Gene Symbols	RNF165
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene ID (Entrez)	494470
Immunogen	Synthetic peptides corresponding to RNF165(ring finger protein 165) The peptide sequence was selected from the middle region of RNF165. Peptide sequence SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNF165 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents