Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF166 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF166 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNF166 Polyclonal specifically detects RNF166 in Human samples. It is validated for Western Blot.Specifications
RNF166 | |
Polyclonal | |
Rabbit | |
NP_849163 | |
115992 | |
Synthetic peptide directed towards the middle region of human RNF166. Peptide sequence RVVCPICSAMPWGDPSYKSANFLQHLLHRHKFSYDTFVDYSIDEEAAFQA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC14381, MGC2647, ring finger protein 166 | |
RNF166 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title