Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF170 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15939020UL
Description
RNF170 Polyclonal specifically detects RNF170 in Human samples. It is validated for Western Blot.Specifications
RNF170 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q96K19 | |
RNF170 | |
Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the C terminal of RNF170. Peptide sequence FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR. | |
20 μL | |
Zinc Finger | |
81790 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DKFZP564A022, FLJ38306, Putative LAG1-interacting protein, ring finger protein 170 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction