Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF170 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RNF170 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15939020
|
Novus Biologicals
NBP15939020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159390
|
Novus Biologicals
NBP159390 |
100 μL |
Each for $487.50
|
|
|||||
Description
RNF170 Polyclonal specifically detects RNF170 in Human samples. It is validated for Western Blot.Specifications
| RNF170 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| DKFZP564A022, FLJ38306, Putative LAG1-interacting protein, ring finger protein 170 | |
| RNF170 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96K19 | |
| 81790 | |
| Synthetic peptides corresponding to RNF170(ring finger protein 170) The peptide sequence was selected from the C terminal of RNF170. Peptide sequence FYLISPLDFVPEALFGILGFLDDFFVIFLLLIYISIMYREVITQRLTR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title