RNF182 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159763

Catalog No. NBP159763

Description

RNF182 Polyclonal specifically detects RNF182 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF182
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: E3 ubiquitin-protein ligase RNF182, EC 6.3.2.-, FLJ40772, ring finger protein 182MGC33993
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Bovine: 86%; Chicken: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N6D2
• Gene Symbols: RNF182
• Immunogen: Synthetic peptides corresponding to RNF182(ring finger protein 182) The peptide sequence was selected from the middle region of RNF182. Peptide sequence LSSTPVVEFYRPASFDSVTTVSHNWTVWNCTSLLFQTSIRVLVWLLGLLY.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 221687
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.