RNF185 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159761

Catalog No. NBP159761

Description

RNF185 Polyclonal specifically detects RNF185 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF185
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BSK65-MONO1, BSK65-MONO2, BSK65-PANC1, BSK65-PANC2, BSK65-TEST1, BSK65-TEST2, BSK65-TEST3, FLJ38628, ring finger protein 185
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Pig: 100%; Xenopus: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96GF1
• Gene Symbols: RNF185
• Immunogen: Synthetic peptides corresponding to RNF185(ring finger protein 185) The peptide sequence was selected from the middle region of RNF185. Peptide sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF.
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 91445
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.