Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF185 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RNF185
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP1597620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15976120UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159761 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159761	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RNF185 Polyclonal specifically detects RNF185 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RNF185
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Zinc Finger
Gene Alias	BSK65-MONO1, BSK65-MONO2, BSK65-PANC1, BSK65-PANC2, BSK65-TEST1, BSK65-TEST2, BSK65-TEST3, FLJ38628, ring finger protein 185
Gene Symbols	RNF185
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q96GF1
Gene ID (Entrez)	91445
Immunogen	Synthetic peptides corresponding to RNF185(ring finger protein 185) The peptide sequence was selected from the middle region of RNF185. Peptide sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNF185 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents