Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF185 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | RNF185 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1597620
![]() |
Novus Biologicals
NBP15976120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159761
![]() |
Novus Biologicals
NBP159761 |
100 μL |
Each for $487.50
|
|
|||||
Description
RNF185 Polyclonal specifically detects RNF185 in Human samples. It is validated for Western Blot.Specifications
RNF185 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
BSK65-MONO1, BSK65-MONO2, BSK65-PANC1, BSK65-PANC2, BSK65-TEST1, BSK65-TEST2, BSK65-TEST3, FLJ38628, ring finger protein 185 | |
RNF185 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q96GF1 | |
91445 | |
Synthetic peptides corresponding to RNF185(ring finger protein 185) The peptide sequence was selected from the middle region of RNF185. Peptide sequence QVCPVCKAGISRDKVIPLYGRGSTGQQDPREKTPPRPQGQRPEPENRGGF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title