RNF207 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154794

Catalog No. NBP154794

Description

RNF207 Polyclonal specifically detects RNF207 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF207
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C1orf188, chromosome 1 open reading frame 188, FLJ32096, FLJ46380, FLJ46593, ring finger protein 207
• Host Species: Rabbit
• Molecular Weight of Antigen: 71 kDa
• Quantity: 100 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 388591
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6ZRF8
• Gene Symbols: RNF207
• Immunogen: Synthetic peptides corresponding to RNF207(ring finger protein 207) The peptide sequence was selected from the N terminal of RNF207 (NP_997279). Peptide sequence CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.