Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF212 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF212 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNF212 Polyclonal specifically detects RNF212 in Human samples. It is validated for Western Blot.Specifications
RNF212 | |
Polyclonal | |
Rabbit | |
Q495C1-5 | |
285498 | |
Synthetic peptides corresponding to RNF212(ring finger protein 212) The peptide sequence was selected from the middle region of RNF212. Peptide sequence LCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38841, FLJ42587, hypothetical protein LOC285498, MGC120227, MGC120228, ring finger protein 212, ZHP3 | |
RNF212 | |
IgG | |
26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title