RNF219 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155064

Catalog No. NBP155064

Description

RNF219 Polyclonal specifically detects RNF219 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF219
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C13orf7, chromosome 13 open reading frame 7, DKFZp686A01276, DKFZp686N15250, DKFZp686O03173, FLJ13449, FLJ25774, ring finger protein 219
• Host Species: Rabbit
• Molecular Weight of Antigen: 80 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5W0B1
• Gene Symbols: RNF219
• Immunogen: Synthetic peptides corresponding to C13ORF7 The peptide sequence was selected from the N terminal of C13ORF7. Peptide sequence LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79596
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG