Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF219 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RNF219 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15506420
|
Novus Biologicals
NBP15506420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155064
|
Novus Biologicals
NBP155064 |
100 μL |
Each for $487.50
|
|
|||||
Description
RNF219 Polyclonal specifically detects RNF219 in Human samples. It is validated for Western Blot.Specifications
| RNF219 | |
| Polyclonal | |
| Rabbit | |
| Q5W0B1 | |
| 79596 | |
| Synthetic peptides corresponding to C13ORF7 The peptide sequence was selected from the N terminal of C13ORF7. Peptide sequence LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C13orf7, chromosome 13 open reading frame 7, DKFZp686A01276, DKFZp686N15250, DKFZp686O03173, FLJ13449, FLJ25774, ring finger protein 219 | |
| RNF219 | |
| IgG | |
| 80 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title