Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF40 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$377.03 - $728.30

Specifications

Antigen	RNF40
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB418147 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18835625UL	25 μL	Each for $377.03	Only null left	Sign In or Register to check your price. Add to Cart

NBP188356 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP188356	0.1 mL	Each for $728.30	Only null left	Sign In or Register to check your price. Add to Cart

Description

RNF40 Polyclonal specifically detects RNF40 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	RNF40
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Chromatin Research, Vision, Zinc Finger
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	9810
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene Alias	95 kDa retinoblastoma-associated protein, BRE1-B, BRE1BMGC13051, EC 6.3.2,95 kDa retinoblastoma protein binding protein, EC 6.3.2.-, KIAA0661BRE1 E3 ubiquitin ligase homolog B, Rb-associated protein, RBP95E3 ubiquitin-protein ligase BRE1B, ring finger protein 40DKFZp686K191, STARING
Gene Symbols	RNF40
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RNF40 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents