Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RNF5 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179711

Catalog No. NBP179711


Only null left
Add to Cart

Description

Description

RNF5 Polyclonal specifically detects RNF5 in Human samples. It is validated for Western Blot.
Specifications

Specifications

RNF5
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
EC 6.3.2.-, G16, HsRma1, NG2, Protein G16, ring finger protein 5Ram1 homolog, RING5hsRma1, RMA1E3 ubiquitin-protein ligase RNF5
Rabbit
20 kDa
100 μL
Primary
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
NP_008844
RNF5
Synthetic peptide directed towards the N terminal of human RNF5The immunogen for this antibody is RNF5. Peptide sequence AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL.
Affinity purified
RUO
6048
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
IgG
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only