RNF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179711

Catalog No. NBP179711

Description

RNF5 Polyclonal specifically detects RNF5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RNF5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2.-, G16, HsRma1, NG2, Protein G16, ring finger protein 5Ram1 homolog, RING5hsRma1, RMA1E3 ubiquitin-protein ligase RNF5
• Host Species: Rabbit
• Molecular Weight of Antigen: 20 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_008844
• Gene Symbols: RNF5
• Immunogen: Synthetic peptide directed towards the N terminal of human RNF5The immunogen for this antibody is RNF5. Peptide sequence AAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6048
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only