Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257378
Description
RNF8 Polyclonal specifically detects RNF8 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RNF8 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
C3HC4-type zinc finger protein, EC 6.3.2, EC 6.3.2.-, FLJ12013, KIAA0646UBC13/UEV-interacting ring finger protein, ring finger protein (C3HC4 type) 8, ring finger protein 8E3 ubiquitin-protein ligase RNF8 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
RNF8 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMI | |
100 μL | |
Stem Cell Markers, Zinc Finger | |
9025 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction