Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RNF98 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RNF98 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RNF98 Polyclonal specifically detects RNF98 in Human samples. It is validated for Western Blot.Specifications
RNF98 | |
Polyclonal | |
Rabbit | |
Zinc Finger | |
A6NDD0 | |
55521 | |
Synthetic peptides corresponding to TRIM36(tripartite motif-containing 36) The peptide sequence was selected from the middle region of TRIM36. Peptide sequence GYIMELIAKGKASAMGLQQTHEHSRLTSKGGEARCPFEISEVGKQSLPRR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Human | |
E3 ubiquitin-protein ligase TRIM36, EC 6.3.2.-, RBCC728RNF98HAPRIN, RING finger protein 98, tripartite motif containing 36, tripartite motif protein 36, tripartite motif-containing 36, Tripartite motif-containing protein 36, Zinc-binding protein Rbcc728 | |
TRIM36 | |
IgG | |
7 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title