Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ROBO2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications

$416.50 - $670.00

Specifications

Antigen	ROBO2
Concentration	0.05mg/mL
Dilution	Western Blot Reported in scientific literature (PMID: 32220420)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockout Validated Reported in scientific literature (PMID: 32220420).
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Classification	Polyclonal

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB419006 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18139925UL	25ul	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP181399 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP181399	0.1 mL	Each for $670.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ROBO2 Polyclonal specifically detects ROBO2 in Human, Mouse, Rat, Monkey samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated.

Specifications

Antigen	ROBO2
Dilution	Western Blot Reported in scientific literature (PMID: 32220420)., Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockout Validated Reported in scientific literature (PMID: 32220420).
Classification	Polyclonal
Host Species	Rabbit
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	6092
Immunogen	This antibody was developed against Recombinant ROBO2 Protein corresponding to amino acids: PVNNSNSGPNEIGNFGRGDVLPPVPGQGDKTATMLSDGAIYSSIDFTTKTSYNSSSQITQATPYATTQILHSNSIHELAVDLPDPQWKSSIQQKTDLMGFGYSLPDQNKGNNGGKGGKKKKNKNSSKPQKNNGSTWA
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Concentration	0.05mg/mL
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunoassay
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	Drosophila) homolog 2, roundabout, axon guidance receptor, homolog 2 (Drosophila)
Gene Symbols	ROBO2
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ROBO2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents