Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ropporin 1-like Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $610.00
Specifications
| Antigen | Ropporin 1-like |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Ropporin 1-like Polyclonal specifically detects Ropporin 1-like in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Ropporin 1-like | |
| Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 83853 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AKAP-associated sperm protein, ASPFLJ23003, FLJ25776, radial spoke head 11 homolog, rhophilin associated tail protein 1-like, ROPN1-like protein, ropporin 1-like, ropporin-1-like protein, RSPH11 | |
| ROPN1L | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title