Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPA4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RPA4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RPA4 Polyclonal specifically detects RPA4 in Human samples. It is validated for Western Blot.Specifications
RPA4 | |
Polyclonal | |
Rabbit | |
Human | |
HSU24186, MGC120333, MGC120334, Replication factor A protein 4, replication protein A 30 kDa subunit, replication protein A complex 34 kd subunit homolog Rpa4, replication protein A4, 30kDa, replication protein A4, 34kDa, RF-A protein 4, RP-A p30 | |
RPA4 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q13156 | |
29935 | |
Synthetic peptides corresponding to RPA4(replication protein A4, 34kDa) The peptide sequence was selected from the middle region of RPA4. Peptide sequence VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title