Invitrogen™ RPA70 Monoclonal Antibody (11H4)

Mouse Monoclonal Antibody

Supplier:  Invitrogen™ MA536226

Catalog No. PIMA536226

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, MCF-7 whole cell, K562 whole cell, COS-7 whole cell, Caco-2 whole cell, A549 whole cell, HEPG2 whole cell, PC-3 whole cell, HEPA1-6 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human lung cancer tissue. ICC/IF: A549 cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing.

Specifications

• Antigen: RPA70
• Classification: Monoclonal
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: P27694, Q8VEE4
• Gene Symbols: RPA1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Monkey
• Product Type: Antibody
• Isotype: IgG2b

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
• Clone: 11H4
• Conjugate: Unconjugated
• Gene: RPA1
• Gene Alias: 5031405K23Rik; 70kDa; AA589576; AW557552; Cb1-727; HSSB; MST075; MSTP075; REPA1; Replication factor A protein 1; replication protein A 70 kDa DNA-binding subunit; Replication protein A 70 kDa DNA-binding subunit, N-terminally processed; replication protein A1; replication protein A1, 70kDa; RF-A; RF-A protein 1; Rpa; RP-A; RP-A p70; RPA1; RPA70; Single-stranded DNA-binding protein
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 6117, 68275
• Content And Storage: -20°C
• Form: Lyophilized