Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIMA536226

Invitrogen™ RPA70 Monoclonal Antibody (11H4)
GREENER_CHOICE

Catalog No. PIMA536226
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIMA536226 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIMA536226 Supplier Invitrogen™ Supplier No. MA536226
Add to Cart
Add to Cart

Description

Mouse Monoclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, MCF-7 whole cell, K562 whole cell, COS-7 whole cell, Caco-2 whole cell, A549 whole cell, HEPG2 whole cell, PC-3 whole cell, HEPA1-6 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human lung cancer tissue. ICC/IF: A549 cell. Flow: A431 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RPA70
Applications Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Monoclonal
Clone 11H4
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene RPA1
Gene Accession No. P27694, Q8VEE4
Gene Alias 5031405K23Rik; 70kDa; AA589576; AW557552; Cb1-727; HSSB; MST075; MSTP075; REPA1; Replication factor A protein 1; replication protein A 70 kDa DNA-binding subunit; Replication protein A 70 kDa DNA-binding subunit, N-terminally processed; replication protein A1; replication protein A1, 70kDa; RF-A; RF-A protein 1; Rpa; RP-A; RP-A p70; RPA1; RPA70; Single-stranded DNA-binding protein
Gene Symbols RPA1
Host Species Mouse
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6117, 68275
Target Species Human, Mouse, Monkey
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG2b
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.