Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579933

Invitrogen™ RPA70 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579933
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579933 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579933 Supplier Invitrogen™ Supplier No. PA579933
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human Hela whole cell, human K562 whole cell, human HepG2 whole cell, human 293T whole cell. ICC/IF: A549 cell. Flow: U251 cell.

This gene Plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair. Binds and subsequently stabilizes single-stranded DNA intermediates and thus prevents complementary DNA from reannealing.
TRUSTED_SUSTAINABILITY

Specifications

Antigen RPA70
Applications Flow Cytometry, Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene RPA1
Gene Accession No. P27694
Gene Alias 5031405K23Rik; 70kDa; AA589576; AW557552; Cb1-727; HSSB; MST075; MSTP075; REPA1; Replication factor A protein 1; replication protein A 70 kDa DNA-binding subunit; Replication protein A 70 kDa DNA-binding subunit, N-terminally processed; replication protein A1; replication protein A1, 70kDa; RF-A; RF-A protein 1; Rpa; RP-A; RP-A p70; RPA1; RPA70; Single-stranded DNA-binding protein
Gene Symbols RPA1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6117
Target Species Human
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.