RPB8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153016

Catalog No. NBP153016

Description

RPB8 Polyclonal specifically detects RPB8 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPB8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA-directed RNA polymerases I, II, and III subunit RPABC3, hsRPB8, II, and III 17.1 kDa polypeptide, II, and III subunit ABC3, polymerase (RNA) II (DNA directed) polypeptide H, RPB8 homolog
• Host Species: Rabbit
• Molecular Weight of Antigen: 17 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: RPABC3.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52434
• Gene Symbols: POLR2H
• Immunogen: Synthetic peptides corresponding to POLR2H(polymerase (RNA) II (DNA directed) polypeptide H) The peptide sequence was selected from the N terminal of human POLR2H. Peptide sequence DLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIE.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5437
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG