RPE65 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310292100UL

Catalog No. NB125485

Description

RPE65 Polyclonal specifically detects RPE65 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RPE65
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: All-trans-retinyl-palmitate hydrolase, BCO family, member 3, BCO3, EC 3.1.1.64, EC:3.1.1.64, EC:5.3.3.22, LCA2, lutein isomerase, meso-zeaxanthin isomerase, mRPE65, p63, RBP-binding membrane protein, rd12, retinal pigment epithelium specific protein 65, Retinal pigment epithelium-specific 65 kDa protein, retinal pigment epithelium-specific protein 65kDa, retinitis pigmentosa 20 (autosomal recessive), retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, RPE65, retinoid isomerohydrolase, sRPE65
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human RPE65. Peptide sequence LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN
• Quantity: 100 μg
• Research Discipline: Cellular Markers, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Sensory Systems, Signal Transduction, Vision
• Gene ID (Entrez): 6121
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified