Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RPE65 Rabbit anti-Human, Polyclonal, Novus Biologicals™

RPE65 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB125485 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB125485 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB125485 Supplier Novus Biologicals Supplier No. NBP310292100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RPE65 Polyclonal specifically detects RPE65 in Human samples. It is validated for Western Blot.

Specifications

Antigen RPE65
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias All-trans-retinyl-palmitate hydrolase, BCO family, member 3, BCO3, EC 3.1.1.64, EC:3.1.1.64, EC:5.3.3.22, LCA2, lutein isomerase, meso-zeaxanthin isomerase, mRPE65, p63, RBP-binding membrane protein, rd12, retinal pigment epithelium specific protein 65, Retinal pigment epithelium-specific 65 kDa protein, retinal pigment epithelium-specific protein 65kDa, retinitis pigmentosa 20 (autosomal recessive), retinoid isomerohydrolase, Retinol isomerase, RP20, RPE65, RPE65, retinoid isomerohydrolase, sRPE65
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human RPE65. Peptide sequence LFKFLSSWSLWGANYMDCFESNETMGVWLHIADKKRKKYLNNKYRTSPFN
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cellular Markers, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience, Sensory Systems, Signal Transduction, Vision
Primary or Secondary Primary
Gene ID (Entrez) 6121
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.