Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RPL24/RLP24 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | RPL24/RLP24 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15547920
![]() |
Novus Biologicals
NBP15547920UL |
20 μL |
Each for $206.00
|
|
|||||
NBP155479
![]() |
Novus Biologicals
NBP155479 |
100 μL |
Each for $487.50
|
|
|||||
Description
RPL24/RLP24 Polyclonal specifically detects RPL24/RLP24 in Human samples. It is validated for Western Blot.Specifications
RPL24/RLP24 | |
Polyclonal | |
Rabbit | |
Q9UHA3 | |
51187 | |
Synthetic peptides corresponding to C15ORF15 The peptide sequence was selected from the middle region of C15ORF15. Peptide sequence FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C15orf15, HRP-L30-iso, L30, RLP24, RPL24, RPL24L, RSL24D1 ribosomal L24 domain containing 1, TVAS3 | |
RSL24D1 | |
IgG | |
19 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title