Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPL28 Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against recombinant human RPL28.

Manufacturer:  Abnova Corporation PAB29428

Catalog No. 89-934-867


Add to cart

Description

Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L28E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants encoding distinct isoforms

Sequence: QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
Specifications

Specifications

RPL28
Unconjugated
Immunohistochemistry (1:500-1:1000) Immunofluorescence (1-4 ug/mL) Western Blot (1:500-1:1000) The optimal working dilution should be determined by the end user.
Liquid
RPL28
Recombinant protein corresponding to human RPL28.
Antigen affinity purification
RUO
Primary
6158
Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Rabbit polyclonal antibody raised against recombinant human RPL28.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
FLJ43307
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit