Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RPL36A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $646.00

Specifications

Antigen	RPL36A
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP257883 View Documents View Product Certificates	Novus Biologicals NBP257883	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403350 View Documents View Product Certificates	Novus Biologicals NBP25788325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RPL36A Polyclonal specifically detects RPL36A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	RPL36A
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	6173
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MVNVPKTRRTFCKKCGKHQPHKVTQYKKGKDSLYAQG
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	60S ribosomal protein L36a, Cell growth-inhibiting gene 15 protein, Cell migration-inducing gene 6 protein, dJ164F3.3 (ribosomal protein L44), L44L, L44-like ribosomal protein, MGC72020, MIG6,60S ribosomal protein L44, ribosomal protein L36a, ribosomal protein L44, RPL36AL, RPL44
Gene Symbols	RPL36A
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RPL36A Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents