RPL5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157126

Catalog No. NBP157126

Description

RPL5 Polyclonal specifically detects RPL5 in Human, A. thaliana samples. It is validated for Western Blot.

Specifications

• Antigen: RPL5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DBA6,60S ribosomal protein L5, MGC117339, ribosomal protein L5
• Host Species: Rabbit
• Molecular Weight of Antigen: 34 kDa
• Quantity: 100 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6125
• Target Species: Human, Mouse, Rat, A. thaliana, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P46777
• Gene Symbols: RPL5
• Immunogen: Synthetic peptides corresponding to RPL5(ribosomal protein L5) The peptide sequence was selected from the N terminal of RPL5 (NP_000960). Peptide sequence RLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only